PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015314-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 87aa    MW: 9176.55 Da    PI: 7.6088
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015314-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY34.25.2e-114333059
                   TT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY 30 agCpvkkkversaedpkvveitYegeHnhe 59
                   +gCpvkk+v+r  ed +++++tYeg+H+h+
  NNU_015314-RA  4 PGCPVKKQVQRFLEDMSILITTYEGTHKHP 33
                   69***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081112.45135IPR003657WRKY domain
SMARTSM007747.4E-4234IPR003657WRKY domain
PfamPF031066.7E-8433IPR003657WRKY domain
SuperFamilySSF1182901.01E-8435IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.6E-10435IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MVAPGCPVKK QVQRFLEDMS ILITTYEGTH KHPLPLGETT GASTTSGAAN FMLPSGSSGA  60
AIPGGIFNDA RIPIPYQNPH LISPLPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246360.17e-48PREDICTED: probable WRKY transcription factor 9
SwissprotQ9C9F08e-21WRKY9_ARATH; Probable WRKY transcription factor 9
TrEMBLA0A068LIA86e-22A0A068LIA8_G
STRINGBra004285.1-P2e-19(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68150.17e-19WRKY DNA-binding protein 9